PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g003020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 702aa    MW: 78896 Da    PI: 5.7113
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g003020.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-182579256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    r+ +++t++q++ Le++F ++++p++++r++L ++l+L  +qVk+WFqN+R++ k
  Csa15g003020.1 25 RTGHRHTPQQIQGLEAFFMECPHPDEAQRQQLCEELKLRLDQVKFWFQNKRTQCK 79
                    555789*********************************************9988 PP

2START118.78.1e-382144343206
                     HHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   3 aeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     a +a +el ++  +ee++Wvkss       +sen+++    +++  +     ++e +++++vv+ ++++l e +ld   +W+e ++    ka+tl
  Csa15g003020.1 214 AASAVEELKRLFFSEEQFWVKSSidgtdliDSENYEKFSNAVKK--FrstsAHVESSKDVTVVPIEATNLIEMFLDAE-KWKELFPtmvnKAKTL 305
                     5678889999999*************888888888887555533..233667************************99.99998888888***** PP

                     EEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
           START  83 evissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                      v+ s        ++l +m  +l  lsplvp R+f++vR++++ ++g w+i+dvS +++ +   ++s   + ++pSg+li++++n  skv w+eh
  Csa15g003020.1 306 YVLGSElpirencNILRVMWEQLHILSPLVPpREFMIVRCWQEISKGLWIIADVSHNVDFDFF-NAS---CYKRPSGCLIQSLPNAQSKVMWIEH 396
                     *****************************************************9977776666.344...5569********************* PP

                     EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 170 vdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     v++  +l  h ++r l++ g   gak+w atl+r ce+
  Csa15g003020.1 397 VEVAHKLDaHKIYRELLSGGSGYGAKRWIATLERMCER 434
                     *******99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-17982IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-181183IPR009057Homeodomain-like
PROSITE profilePS5007115.372181IPR001356Homeobox domain
SMARTSM003893.3E-172385IPR001356Homeobox domain
CDDcd000863.61E-162482No hitNo description
PfamPF000464.9E-162679IPR001356Homeobox domain
PROSITE profilePS5084840.114203437IPR002913START domain
SuperFamilySSF559616.32E-26205435No hitNo description
CDDcd088755.51E-83208433No hitNo description
SMARTSM002343.2E-20212434IPR002913START domain
PfamPF018522.9E-31214434IPR002913START domain
Gene3DG3DSA:3.30.530.201.7E-6215393IPR023393START-like domain
SuperFamilySSF559614.67E-8455666No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MENDGSGSSC NEQYASEDSN QSGKRTGHRH TPQQIQGLEA FFMECPHPDE AQRQQLCEEL  60
KLRLDQVKFW FQNKRTQCKA QEERAENLSL HRENEILKSE NEAIFGALSS VLCPDCGGPP  120
FGREKRAVNF QKLLLENVRL KEQRDKISHF LSNMSKRPTV GDSFASVPTQ HISSYGINPS  180
NMFDPFSSFG PPTSQPIQPQ PISQMDVSLL SETAASAVEE LKRLFFSEEQ FWVKSSIDGT  240
DLIDSENYEK FSNAVKKFRS TSAHVESSKD VTVVPIEATN LIEMFLDAEK WKELFPTMVN  300
KAKTLYVLGS ELPIRENCNI LRVMWEQLHI LSPLVPPREF MIVRCWQEIS KGLWIIADVS  360
HNVDFDFFNA SCYKRPSGCL IQSLPNAQSK VMWIEHVEVA HKLDAHKIYR ELLSGGSGYG  420
AKRWIATLER MCERMALTSY LTLPASDWSE VIRTGEERRR VLKLGERMIM NFNEMLTMSG  480
KVDFPQQSKC GVRVSMRMNL EAGQPPGLIV SAASSLRIPL PPVQVFDILR KLDTRQQWDV  540
LAYGTVVTEI ARIATGSSET NCLSILRVHP TQEENNNGKM IAQESDKDDM LMLQDCYMDA  600
LGGMLVYAPM DMATMDTTLS GADVKISDIP ILPSGFIISS DGRRSTVEDG GTLLTLAFQI  660
LVSGRTSRSR EVNERSVDTV SALISSTVQR IKGLLNCPDQ F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010463776.10.0PREDICTED: homeobox-leucine zipper protein HDG8-like
SwissprotQ9M9P40.0HDG8_ARATH; Homeobox-leucine zipper protein HDG8
TrEMBLR0HRS60.0R0HRS6_9BRAS; Uncharacterized protein
STRINGAT3G03260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM127911530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.10.0homeodomain GLABROUS 8